PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 297aa    MW: 33244.3 Da    PI: 6.6006
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028812.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd ll+++++ +G g+W++ a+  g++Rt+k+c++rw++yl
      Pbr028812.1 15 KGPWTLEEDNLLIHYIANHGEGHWNSLAKFAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding52.71e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Pbr028812.1  68 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.2491062IPR017930Myb domain
SuperFamilySSF466894.39E-3113109IPR009057Homeodomain-like
SMARTSM007172.3E-151464IPR001005SANT/Myb domain
PfamPF002495.4E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-231669IPR009057Homeodomain-like
CDDcd001675.27E-131762No hitNo description
PROSITE profilePS5129425.75163117IPR017930Myb domain
SMARTSM007172.7E-1567115IPR001005SANT/Myb domain
PfamPF002491.0E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2370116IPR009057Homeodomain-like
CDDcd001671.00E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MAAPRNPNEE HALRKGPWTL EEDNLLIHYI ANHGEGHWNS LAKFAGLKRT GKSCRLRWLN  60
YLKPDIKRGN LTPQEQLLIL ELHSKWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKQARQL  120
NIESNSVQFL DAVRGFWMPI LLQKMKQSSC SSTLSPSQNS ASPSLSPNHT VPSVPLPTSP  180
PGNVTNMFDN YHMSGTSNLA TVPSNILSSE SLISQVPQMA EQSTSLYPAF DHIGYGGLSP  240
DGSYYVDSSS YDMEGLNLDP VSGMGNYDNS QFDCQMVGND WMLDTITDNL WNMDGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25131175108B-MYB
1h8a_C4e-251311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744620.0DQ074462.1 Malus x domestica MYB7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356251.10.0PREDICTED: transcription factor MYB108-like
TrEMBLQ2LMF01e-174Q2LMF0_MALDO; MYB7
STRINGPOPTR_0008s12130.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-81myb domain protein 62